"initiatorBinding" : true, "linkDisabled" : "false" //if(height > 430) { }, ] "activecastFullscreen" : false, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1574152 .lia-rating-control-passive', '#form_3'); { ] { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8SiRxuIYnvC0iJsla6iJnMCO_ZHObch_4YZr0q0fuWg. }, } if ( watching ) { "action" : "rerender" "context" : "envParam:quiltName", "useCountToKudo" : "false", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1526334}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1528934}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1573018}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1574120}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1574152}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1574219}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1574243}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2021769}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1646580}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1419101}}]); { "event" : "ProductMessageEdit", } ] "includeRepliesModerationState" : "false", "event" : "ProductAnswerComment", { "selector" : "#kudosButtonV2_1", "forceSearchRequestParameterForBlurbBuilder" : "false", { "event" : "QuickReply", "useSimpleView" : "false", "actions" : [ }, ] LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "removeThreadUserEmailSubscription", ] // console.log(key); "displayStyle" : "horizontal", ] { }, "actions" : [ { }, "quiltName" : "ForumMessage", }); "displaySubject" : "true", }); LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { "context" : "", "componentId" : "forums.widget.message-view", }, { }; if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { ] "event" : "editProductMessage", "}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.Dialog.options['553595914'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; ] { // Oops, not the right sequence, lets restart from the top. "actions" : [ LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" "action" : "rerender" "event" : "expandMessage", }, "actions" : [ } { "entity" : "1574152", "actions" : [ "useSubjectIcons" : "true", "displaySubject" : "true", "useTruncatedSubject" : "true", }, } "action" : "addClassName" LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "parameters" : { ] ] "disableLinks" : "false", "actions" : [ "selector" : "#messageview_1", "context" : "envParam:quiltName,product,contextId,contextUrl", { ] ] "actions" : [ "selector" : "#messageview", "actions" : [ "quiltName" : "ForumMessage", "componentId" : "kudos.widget.button", "actions" : [ "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "action" : "rerender" }, ] { "actions" : [ { ] LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); "actions" : [ ', 'ajax'); } "context" : "", "event" : "expandMessage", LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "event" : "addThreadUserEmailSubscription", LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "revokeMode" : "true", "action" : "rerender" "action" : "rerender" "action" : "rerender" }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Tl7R5vE-k5z4fKMYgy3QGdx5L4OSZOzwbdkGNII1n3k. LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); { "action" : "rerender" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "context" : "", resetMenu(); "useSubjectIcons" : "true", "includeRepliesModerationState" : "false", } { } }, "componentId" : "forums.widget.message-view", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "context" : "", //if(height > 430) { { "event" : "ProductAnswerComment", "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "selector" : "#messageview_0", }, "initiatorBinding" : true, ] "context" : "", // --> } "actions" : [ "truncateBodyRetainsHtml" : "false", "actions" : [ "useSimpleView" : "false", }); // --> "event" : "MessagesWidgetAnswerForm", "disableLabelLinks" : "false", Bist du sicher, dass du fortfahren möchtest? { LITHIUM.Loader.runJsAttached(); "action" : "rerender" }, Um dies zu überprüfen, starten Sie in Windows den Task-Manager Task-Manager. "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity_2', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, 'Z6qg4bh8LwlUDWNpuD5gcbw7vWr26bhvnXJ8nOJYHYQ. { "messageViewOptions" : "1111110111111111111110111110100101001101" "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "event" : "MessagesWidgetCommentForm", { "truncateBody" : "true", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "context" : "lia-deleted-state", } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); $(document).ready(function(){ LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":678,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaREtXBAdFAUcRDhANQhJJQVg+GDgaVVtAEFtIT10GA1ELW1YaVgBqSU0HPk12FlZbXURIewNQXE80WABUVVtcABsrXFsMT3wFV1ZYbkp7A1BcB09hC1FSUl0LU0t4QhJPRBBUQUBXERsIUFEKFmtLQVcZQjkZVwwAVFEEUBcfFlQXVwtcewZADVUHBwILUQJVAAZVVBtGXlBhQQBEL10QWE8GSBdYV2IEUQN3Uw8HFV4XdVtAEFsyVkILAWcFUlYWHkddBXRdAAtbARcJFlQEWhVcEE5AXAd3XEAQXxQAWF4RBxVIF1hXZh0UXBsCA1sGAANSUR8EBVEKH1YDD10YCgBXVxtTXQcABg5RBFJVBVQUShtZASxYAFB6UBBfFCdLUQoLQSlQWlpkClIHX10MB3oBXF1\/UwdTCnx\/AwtbRhkRX1E3UxVNZFAzQgFHShYIR2UjdXchNhcNURNyYCp7RlRXERFWA1BAFGUtczR8EhYNRw1WHV1WWAlGdXsvK2NEChFJTw=="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ } { "useTruncatedSubject" : "true", { "actions" : [ LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "unapproveMessage", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivMeinVodafoneMeinKabelEMail/thread-id/24770","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8SiRxuIYnvC0iJsla6iJnMCO_ZHObch_4YZr0q0fuWg. "action" : "rerender" "action" : "pulsate" ] "context" : "envParam:feedbackData", }, "context" : "", "context" : "envParam:quiltName", "action" : "rerender" "actions" : [ { "showCountOnly" : "false", { '; "context" : "envParam:quiltName", "context" : "", { "action" : "rerender" }); "actions" : [ { "action" : "rerender" notifCount = parseInt($(this).html()) + notifCount; { // Oops. "action" : "rerender" "event" : "addMessageUserEmailSubscription", ] "eventActions" : [ "event" : "MessagesWidgetMessageEdit", } }, "useSubjectIcons" : "true", }, "event" : "markAsSpamWithoutRedirect", "actions" : [ element.find('li').removeClass('active'); "initiatorDataMatcher" : "data-lia-message-uid" "linkDisabled" : "false" LITHIUM.AjaxSupport.useTickets = false; { { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] ] ] } "displayStyle" : "horizontal", { Private Daten erfragen wir bei Bedarf. { }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", "action" : "rerender" "eventActions" : [ }, } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_6","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "MessagesWidgetEditAction", "actions" : [ }, { })(LITHIUM.jQuery); } }, { "context" : "envParam:feedbackData", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "action" : "rerender" "entity" : "1574243", } { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); "triggerEvent" : "click", } { "kudosLinksDisabled" : "false", { "event" : "MessagesWidgetEditCommentForm", "event" : "MessagesWidgetEditAnswerForm", "kudosable" : "true", "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "removeThreadUserEmailSubscription", "context" : "", "event" : "MessagesWidgetMessageEdit", "kudosLinksDisabled" : "false", "actions" : [ }, }, "initiatorBinding" : true, $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() ] "initiatorBinding" : true, ] { ] { }); "displaySubject" : "true", "actions" : [ Bewertet hilfreiche Beiträge mit Likes und Sternen!Unaufgeforderte PNs werden nicht beantwortet - Bitte erstellt einen Thread. }); "actions" : [ }, } "context" : "envParam:quiltName", "actions" : [ }, { ;(function($) { }); "useTruncatedSubject" : "true", { "context" : "envParam:entity", } ] "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", .attr('aria-expanded','true') "context" : "", "actions" : [ { { { "context" : "envParam:quiltName", }, "action" : "rerender" ;(function($) { { { "eventActions" : [ { ] } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "context" : "envParam:quiltName", "event" : "QuickReply", "event" : "AcceptSolutionAction", "action" : "rerender" { }, { watching = false; "entity" : "1574152", "event" : "expandMessage", "context" : "", } } window.scrollTo(0,position_x.top - 150); "includeRepliesModerationState" : "false", { "event" : "ProductAnswer", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ }, }, "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", "truncateBody" : "true", { } "context" : "", "context" : "", }, { } LITHIUM.AjaxSupport.useTickets = false; })(LITHIUM.jQuery); "context" : "envParam:quiltName", LITHIUM.AjaxSupport.useTickets = false; { "action" : "pulsate" ] } Vor allem bei älteren Geräten mit älterer Firmware kann es helfen, einfach eine komplett neue App zu installieren. ], { "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, } "disableLabelLinks" : "false", "action" : "rerender" "actions" : [ "event" : "deleteMessage", ] { ] // We're good so far. ] ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "context" : "", "action" : "rerender" { Die Community hilft!#bleibtgesund. LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1574152 .lia-rating-control-passive', '#form_3'); ', 'ajax'); element.removeClass('active'); "action" : "pulsate" var keycodes = { "action" : "pulsate" "triggerEvent" : "click", "event" : "RevokeSolutionAction", "eventActions" : [ "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }, "action" : "rerender" { "action" : "rerender" "useTruncatedSubject" : "true", habe das mal gemacht und ja dann funktioniert es erstmal, bis ich die app wieder richtig schließe (alle geöffneten Tabs löschen) dann geht es wieder nicht. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "action" : "rerender" "actions" : [ "action" : "addClassName" "action" : "rerender" }); "actions" : [ "linkDisabled" : "false" "componentId" : "forums.widget.message-view", }, "event" : "addThreadUserEmailSubscription", "disableLinks" : "false", $(this).next().toggle(); }, $(document).keydown(function(e) { ', 'ajax'); }); "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { } }, "event" : "MessagesWidgetEditAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "disallowZeroCount" : "false", } LITHIUM.Loader.runJsAttached(); "}); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); if ( watching ) { })(LITHIUM.jQuery); "revokeMode" : "true", "componentId" : "forums.widget.message-view", "actions" : [ }); LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; "action" : "rerender" $('#vodafone-community-header .lia-search-toggle').click(function() { { "context" : "", "event" : "approveMessage", }, } "actions" : [ { "actions" : [ } ] "event" : "QuickReply", "event" : "AcceptSolutionAction", // We made it! }, "context" : "envParam:quiltName,message", }, ] "componentId" : "forums.widget.message-view", "event" : "removeMessageUserEmailSubscription", "event" : "expandMessage", "actions" : [ }); "action" : "addClassName" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }, "event" : "approveMessage", { "actions" : [ return; }, } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }); ] "action" : "rerender" "event" : "ProductMessageEdit", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl",

Geburtstermin Nach Hinten Korrigiert, Ariston Hofheim Speisekarte, Katholischer Orden Kreuzworträtsel, Uniklinik Regensburg Essen, Ikea Besteck 24 Teilig, Der Jägerhof Brilon Speisekarte, Steakhouse Bergedorf Lohbrügge, Kino Fürth öffnungszeiten, Blz Hamburger Volksbank, Srh Fachschule Für Logopädie Bonn, Peking Suppe Tiefgefroren, Preunegg Jet öffnungszeiten, International Business Administration, Veranstaltungen Auerbach/vogtland Heute, Bounty Brotaufstrich Thermomix,

Artículos Relacionados

Partybus